SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153006132|ref|YP_001380457.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153006132|ref|YP_001380457.1|
Domain Number 1 Region: 223-274
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000652
Family Tetracyclin repressor-like, N-terminal domain 0.076
Further Details:      
 
Domain Number 2 Region: 276-321
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000986
Family AraC type transcriptional activator 0.016
Further Details:      
 
Weak hits

Sequence:  gi|153006132|ref|YP_001380457.1|
Domain Number - Region: 55-95
Classification Level Classification E-value
Superfamily RmlC-like cupins 0.00285
Family Gentisate 1,2-dioxygenase-like 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|153006132|ref|YP_001380457.1|
Sequence length 327
Comment helix-turn-helix domain-containing protein [Anaeromyxobacter sp. Fw109-5]
Sequence
MPDDARNHLLGDRTLCPPASPADLLSEVLQDLRLAQASYGRSELTAPFGIEIPFKEGVRF
HFVVEGGCWILSAAREPIRLDAGDVVLLPHGTAHVMADRPGRRPLPLAEVAPHLIGNASY
RIAHGGGGPRSLIVCCTIAFDGPTANPLLEMLPPVLLVRRAETRDPMLSQLLEMMAGEVM
ERRIGSVTIMARLADIVMTSIIRSWIEGQGDSNVSGWLAGVRDPQIGLALARIHRNPGHP
WTVETLAAAAGMSRSSFAQRFVQLLNVSPARYLLQWRMRLAATWLRSGSMTVAEAAAQVG
YDSDAGFSRAFKRAMGLPPVAAWMLPP
Download sequence
Identical sequences A7HFH7
404589.Anae109_3284 WP_012098092.1.20576 gi|153006132|ref|YP_001380457.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]