SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153006197|ref|YP_001380522.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153006197|ref|YP_001380522.1|
Domain Number 1 Region: 172-371
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000000096
Family GAF domain 0.012
Further Details:      
 
Domain Number 2 Region: 444-555
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.000000407
Family Histidine kinase 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|153006197|ref|YP_001380522.1|
Sequence length 555
Comment histidine kinase [Anaeromyxobacter sp. Fw109-5]
Sequence
MPPPTAPPERQELLTSALRVIVAIGALIIYLGDPSEHPSRRPFAQAVLALFVTYAALGYA
SARRGRPVSSAAAPWIDLAWVSLLVAVSQATSSIFYPLYLFAILCASFWRGFRSGIAVTL
ASAVSFAAIGALTAPQAPGLELRSFVVRPLYLLVLGYLTAVWGGREVRSRARLALLREVT
ALSNPRFGIDRTVAHVLEAIRAFYDAESCRVVVAEEHSGRRWMWAAARDGVPSGKRVALP
QELADELLAVPEELALLVRPRLGGRDALDFELVELSTGLHSRGDLEVARALVTALDAGTL
LSVPFRYHANARGRLYVAHRGSFGHDRGDLEFLRQVVDQVVPMLDNVRLVDRLASEAAEE
ERRRIARDLHDSVIQPYLGLRLGLAAARKAFEGGRTEEAGGHVARLVEVADAEIQTLRGY
VRELRAADGRANGSVLDAAVHRFCGRFSAATGIHVDVVAEGLPLGGDRLAAEVFQMVAEA
LSNVRRHTSATRAEIRIACAGERLRLTVTNDGTPEAAREGFVPRSLAERAEALGGTLRIE
HPAPGKTAVEVEIPL
Download sequence
Identical sequences A7HFP2
gi|153006197|ref|YP_001380522.1| WP_012098157.1.20576 404589.Anae109_3354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]