SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153006202|ref|YP_001380527.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153006202|ref|YP_001380527.1|
Domain Number 1 Region: 361-599
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.62e-75
Family Extended AAA-ATPase domain 0.00000104
Further Details:      
 
Domain Number 2 Region: 158-334
Classification Level Classification E-value
Superfamily GAF domain-like 3.27e-25
Family GAF domain 0.017
Further Details:      
 
Domain Number 3 Region: 36-148
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.54e-22
Family Flavin-binding PAS domain 0.086
Further Details:      
 
Domain Number 4 Region: 575-670
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000851
Family FIS-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|153006202|ref|YP_001380527.1|
Sequence length 674
Comment NifA subfamily transcriptional regulator [Anaeromyxobacter sp. Fw109-5]
Sequence
MTEVATRYDERGITMDTPPSLRTPGQQAMTDEGWHQLFEHSAIGVTLADLEGHLVHVNRA
YCAMLGYTEVELEGHSYVSHAHPDDRARHLILVRELLADARAHFQVEERYVRKGGSVMWV
SNSVSLVPPRGGSRRILILGLVEDITERMRLRDELDAERNRLRLLLDVNELLVAHLDLRE
MFQALASSLRRVTDCHFIGLALPDAATGELRQHIVDHPDGKGAITEGMVLPLHGSASGKA
FRTGAPVLLNDPEANRQDPDLYGTPEGARFYRTVLEEGVPSGYVLPLVHRGEVLGVLQLK
KYADARFKEREIEFMSKVAGQLSIAVANALEYREVKESKERLDRERVYLKEEIRSAHDFE
EIIGVSRTLKQVLGQIDTVAVTDSTVLILGETGTGKELIARAIHNRSRRRDRPFVKVNCS
AIPTGLLESELFGHERGAFTGATAPRIGRFEAADQGTLFLDEIGDLPVDLQPKLLRVLQE
REFERLGASRTRRVDVRVVAATNRGLATMVGEGRFREDLYYRLNVFPITLPPLRERAGDI
PLLVRHFVGVYARRMGKQIDHIPDASMRALVGYHWPGNVRELQNVIERAVILTPGAVLEL
ALAERAAGAREDRPDAAAPNGHRTLQEVEREHILGALQEAKWVIGGPNGAAARLGLRRTS
LMYRMEKLGIARPT
Download sequence
Identical sequences A7HFP7
gi|153006202|ref|YP_001380527.1| 404589.Anae109_3359 WP_012098162.1.20576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]