SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153006633|ref|YP_001380958.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153006633|ref|YP_001380958.1|
Domain Number 1 Region: 381-549
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 8.38e-46
Family Histidine kinase 0.00054
Further Details:      
 
Domain Number 2 Region: 569-691
Classification Level Classification E-value
Superfamily CheY-like 3.7e-35
Family CheY-related 0.0056
Further Details:      
 
Domain Number 3 Region: 314-393
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 8.44e-20
Family Homodimeric domain of signal transducing histidine kinase 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|153006633|ref|YP_001380958.1|
Sequence length 725
Comment histidine kinase [Anaeromyxobacter sp. Fw109-5]
Sequence
MDGSRDIPLLDRGAVARMHQVSRVAAAIAALIGVVALASYPLGTPLLRSFGRAIEMQPNA
ASGVLAAAVGLLLAGLPMRWARIGSRVIGAGVAALGAATLFQHLTGLDLGIDRLLVPALT
PSAAVTSPGRPGPPAALNMLIVGAVLIGLDARRRFAWLAQVLAVAATALGLLGVVGHVYG
VTLLYGQATVTGIAFPTALSLLALDVGLLCARPDRGFVANVASTGAGSALARRLLVYVLL
LPVLLGGASLAVADAGEGGGLAVSLLVVVLSLLFVVLVLRDAVAIDRMEAGKIRAQQERA
ASREELAHALRREQDARAHAESANRAKDEFLATLSHELRTPLNAILGWSGLLRDAGGDPE
RLARGLAVIDRNGRTLAQLVSDLLDMSRIAAGRIEVEHADVDLLAVVDDAIEAVRAAARA
KGVAISRSAGPELPRVVGDAGRLRQVAWNLVSNAVKFTPPGGSVDVRLGREGGAAVLEVK
DTGVGMSRDFLPIMFDPFVQAEGSSVRRHGGLGLGLAITKQLVALHGGTIHAESDGPGRG
STFRVLVPETARTPALAPVVAGTRRELGGARVLVVDDEGDSRDVLLQLLTSWGAQAVGAA
SVREALEAIAREPPDLIVSDIAMPGEDGFSFVRELRRLEAARGERPVPVAALTAFARPED
RQRALSAGFDAHLAKPVDPTTLHATIAGLLRDGRGGGGARPASGPVPAAAPGAPQQGGED
ALAAG
Download sequence
Identical sequences A7HGX8
gi|153006633|ref|YP_001380958.1| 404589.Anae109_3795 WP_012098602.1.20576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]