SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153006691|ref|YP_001381016.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153006691|ref|YP_001381016.1|
Domain Number 1 Region: 413-573
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.31e-42
Family Histidine kinase 0.00075
Further Details:      
 
Domain Number 2 Region: 57-166
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.36e-26
Family Heme-binding PAS domain 0.095
Further Details:      
 
Domain Number 3 Region: 170-358
Classification Level Classification E-value
Superfamily GAF domain-like 7.46e-23
Family GAF domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|153006691|ref|YP_001381016.1|
Sequence length 591
Comment multi-sensor signal transduction histidine kinase [Anaeromyxobacter sp. Fw109-5]
Sequence
MPLGREPPCLRHLRDVVERAARDSTPEEAAALRAEVRDLVEERELAEAIIEQSAALVVVL
DREGLIRRWNAACARITGYSADEMLGQPVWNLLVPEEREGVRGTFARLVAGSLASTFENQ
WVARDGERRLVSWSNAALLDDAGEVRAIVATGLDITERKRAELALRGHAKRLEALAEASR
VFASGLDYRTTLDTVARRLAELIGDGALIRIVSPDGAWLVPVAVYHPSPERAALRRRIIA
AAPQRTNEGITAGPLATGRTLRIPHLSRETVRNEMKPEYYPYLEGVTSLLIAPLAQRNEV
FGHITLMRDAGGAPYTVEDEALLEDLAHRAAQAIENARLYSEAQNAVAARDEFLSIASHE
LRTPLTALRLALGNMRRVTSREALERLPPEHVERVLAAAERQGQRLEKLVAALLDVSRIH
MGKLELELDEVELGAVVSDALTQLEDEASQTGSTLSAAGEPVLGAWDRLRLSQVITNLLS
NAVKYGAGKPVEVSYGPSAAGAYVRVRDHGIGIAPTDQRQIFERFERAVSSRNYGGLGLG
LYIVRRIVEAHGGTIRVESTPGEGSEFRVELPLRPLCARPLRGEAPQGAKR
Download sequence
Identical sequences A7HH36
404589.Anae109_3853 gi|153006691|ref|YP_001381016.1| WP_012098666.1.20576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]