SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153006695|ref|YP_001381020.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153006695|ref|YP_001381020.1|
Domain Number 1 Region: 19-134
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.94e-28
Family Heme-binding PAS domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|153006695|ref|YP_001381020.1|
Sequence length 145
Comment putative PAS/PAC sensor protein [Anaeromyxobacter sp. Fw109-5]
Sequence
MDDLGFEGIAARIVEETGDAILFADRDGVVRLWNRGAERMFGFSAAEAIGQSMDFIIPER
LRQRHWDGWKRVMETGVTRYGTEVLAVPALRKDGQTLSIEFTIQLIRDASGRILGPSAVI
RDVTARFKREKELRARLKELEARAG
Download sequence
Identical sequences A7HH40
WP_012098670.1.20576 gi|153006695|ref|YP_001381020.1| 404589.Anae109_3857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]