SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153006931|ref|YP_001381256.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153006931|ref|YP_001381256.1|
Domain Number 1 Region: 799-1025
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.57e-44
Family Multidrug efflux transporter AcrB transmembrane domain 0.0004
Further Details:      
 
Domain Number 2 Region: 291-497
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.83e-38
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000469
Further Details:      
 
Domain Number 3 Region: 43-132
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 6.28e-22
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0027
Further Details:      
 
Domain Number 4 Region: 140-183,269-319
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 3.14e-20
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0053
Further Details:      
 
Domain Number 5 Region: 713-797
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00000000000000183
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.012
Further Details:      
 
Domain Number 6 Region: 184-266
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00000000000000353
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.0065
Further Details:      
 
Weak hits

Sequence:  gi|153006931|ref|YP_001381256.1|
Domain Number - Region: 562-655
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.000173
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|153006931|ref|YP_001381256.1|
Sequence length 1045
Comment CzcA family heavy metal efflux protein [Anaeromyxobacter sp. Fw109-5]
Sequence
MIDAVIRWSLTHRLVVLLGAGILLAWGSVVAVRMPVDVFPDLTAPTVTVIAEAHGMAPQE
AESQIAFPIETALNGAPGVRRVRSASGIGIAIVWAEFEWGTDIYQARQVVAEKLQLAQSA
LPPGADAPVLAPVSSIMGEILFIALTSERHTPMDLKTTADWTIRRRLLAVPGVSQVVPTG
GDTKQYQVVLRPDRLSAYGLTADEVVRALRATNENASAGFYLEGGQQFLIHGVGRVRTPA
DLGETVVAVRGTEPVLVRQLGEVRLGPAMKLGEGSHDGRQAVVLGIQKQPGANTLELTKR
LDAELDAIQQTLPEGMEIDRHIFRQADFIEIAIGNVVGALRDGALLVVAIVFLFLASARA
TGITVLAIPLSLVTAILAMRALGASINTMTLGGMAIAVGALVDDAIIDVENVVRRLREDR
GRGGQLHYLGIVFEASREIRGSIVYATLIIVLVFLPLFFLSGVEGRLLQPLGFAYVVSLA
ASLLVALTVTPALCLTVLPNARAVRESREGRLVHWLKARYEPLLGRVLPRWRLAAAAGMG
LLAAAALALALAGRAFLPEFNEGTLTLSAVTLPGTSLEESNRLGGMVEQLLLKHPEVVAT
ARRTGRAELDEHAQDVNSAEIDVGLRMKDRSKEELLAALRRDFAGIPGLNVTIGQPISHR
IDHMLSGTRANVAVKIFGDDLVELRRLGEQVRGAMSTVPGVVDLSLEQQPDIPLLTVRFD
RAAIARHGLRIRDVAESIETAFQGTTVSRVLEGQASFDVVVRYDRSALSDLEAIRATLVA
TPSGARVPLHALAEIRKDRGPSMVTRENVQRKVVVMCNVAGRDLGSVVHDLRAGIEASVE
MPRGYHVEYGGQLESAEEAVRTLVLLGVAVIAGIFLLLYLALRSGRDSALVMVNLPLALA
GGAAGVYLSGGVLSVASIIGFITLFGIATRNGLMLVSHVQHLVEQEGVTDAETAVRRGAL
ERLSPILMTALATGLGLVPLALAGGQPGSEIETPMAVVILCGLVTSTALNMLVVPALYLR
FGSVRRTLMATAEGRAREPRGDGAS
Download sequence
Identical sequences A7HHS6
404589.Anae109_4094 WP_012098911.1.20576 gi|153006931|ref|YP_001381256.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]