SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153006997|ref|YP_001381322.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153006997|ref|YP_001381322.1|
Domain Number 1 Region: 127-294
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.31e-45
Family Histidine kinase 0.0012
Further Details:      
 
Domain Number 2 Region: 62-139
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 5.1e-20
Family Homodimeric domain of signal transducing histidine kinase 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|153006997|ref|YP_001381322.1|
Sequence length 311
Comment histidine kinase [Anaeromyxobacter sp. Fw109-5]
Sequence
MKLRRVLPLVIGFVLVPAALMLTVGILILVYGTLPRDYVFGWLIVALVATTIFGSAATLA
VIFREARLAKLQTEFVNKVSHDLRTPLTSIRMFVETLQLGRIPDPARQREALEIISEETA
RLSGLINRLLDWARMESGRRTYQLVRQPLAPIVDAALEAFEAMLLQHAAEVDCHIAPALP
LVMADREALSEAILDLLQNAHKYTGPEKRIAVRVEASGPTVQISVTDNGPGIPEREHKRI
FKKFYRARDPLSRTIEGTGLGLAMVKHIANGHGGKVSVASKVGHGATFTISLPAAGVTEQ
APQAERAARPA
Download sequence
Identical sequences A7HHZ2
WP_012098977.1.20576 404589.Anae109_4160 gi|153006997|ref|YP_001381322.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]