SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153007079|ref|YP_001381404.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153007079|ref|YP_001381404.1|
Domain Number 1 Region: 326-563
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.49e-69
Family Extended AAA-ATPase domain 0.00000129
Further Details:      
 
Domain Number 2 Region: 31-179
Classification Level Classification E-value
Superfamily GAF domain-like 6.17e-20
Family GAF domain 0.026
Further Details:      
 
Domain Number 3 Region: 167-240
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000162
Family Heme-binding PAS domain 0.028
Further Details:      
 
Domain Number 4 Region: 581-641
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000421
Family FIS-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|153007079|ref|YP_001381404.1|
Sequence length 660
Comment sigma-54 dependent trancsriptional regulator [Anaeromyxobacter sp. Fw109-5]
Sequence
MQPSEVTAERRIDEELALRAVVEGTASETGQEFYRALVRNLAQALDTYGAWLTEYDEQRD
RLRALAFWFGGQWMEGFEYGIAGTPCETAVRERRVVHVPDRVIELYPSDEVRFPRSGVVS
YLGVPLLGADQRVLGHLAVVDIRPIPAEKRLLTLFGIFANRAVAEVRRVRVEAELRERQE
KLSGLIGSAMDAIVEFDGDFRITLLNAAAEKTFGCIAVERRGRPAEELLGAAATAKLRAL
SGELERRAGGERSLWIPDGLVAEPPGRKPFPAEATLSRFEVRGRPFFTLILRNVDERVEA
ERRIRALTAHADYLREELAAEHGFHEILGRSPALRRALQDVTQVAATEATVLLVGETGTG
KELFARAIHDRSARRARPLVKVNCAAIPATLIESEFFGHERGAFTGATQRRDGRFALADG
GTIFLDEIGELPLELQGKLLRVLQEGEFEPVGASRTRRVDVRVVAATNRDLQRAAREGTF
RQDLYYRLSVFPIQLPPLRERGDDVVLLAAAMAEKLAPGLGRRVAPPDAADAAALRSYPW
PGNVRELRNVVERAIITSTDGRLNLHRCLPAPAVAPASEPAPATRGDPEVLTDRRLRELE
RDNLLAALERTRWRVGGKDGAAALLSVSPSTLKSRMKALGIARPAAGAGAGAALGDLAHR
Download sequence
Identical sequences A7HI74
WP_012099063.1.20576 404589.Anae109_4242 gi|153007079|ref|YP_001381404.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]