SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153007088|ref|YP_001381413.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153007088|ref|YP_001381413.1|
Domain Number 1 Region: 494-658
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.19e-36
Family Histidine kinase 0.00083
Further Details:      
 
Domain Number 2 Region: 146-255
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.96e-25
Family Heme-binding PAS domain 0.026
Further Details:      
 
Domain Number 3 Region: 272-424
Classification Level Classification E-value
Superfamily GAF domain-like 4.58e-20
Family GAF domain 0.0075
Further Details:      
 
Domain Number 4 Region: 426-505
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000765
Family Homodimeric domain of signal transducing histidine kinase 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|153007088|ref|YP_001381413.1|
Sequence length 674
Comment multi-sensor signal transduction histidine kinase [Anaeromyxobacter sp. Fw109-5]
Sequence
MTHSPTDPGRIDGRRPWAFAAAIALAAAALAATHLLAEMLGGPRYSFALAAVALAAGVGG
TGAGLLAGVASAAGHAWLFLAPRQSLWIADRADALGLAGYLASACVVAVVVGAFRAAQRR
AQGGLSDARAAEERLRLMTEGLHAHAILLLDPSGAVTGWNATAERLTGWPEAEIFGQSFG
RFHPPEERDAGRPEQLLWRATRDARAEEEGWRVRKDGTRFYATVVLTALRDADGRLTGFA
HVMRDITERRRAEEAERFSLEAGAVLAESIHPEEMLERLARLAVPRVADWCVIETLEGDR
QLRLVALAHPDPRREHALRELRLRFPPDPDTSPVWRALRTGQPEVASEGDAAALAALAPE
PEHREALRAEGLRAWVVVPLTAGRRTLGALTLAVSTPDRDFGSRELGIARDLARRAAQAL
HDASLYLEAQRAGRERDEVLAILSHDLRAPLGAAFAAARAIRADTPEGPTGERIRRSAVA
VERAAEAMSRLVADLLDLAGLEAGRLVVVRRPEHTAALVRAAVEAQREAAARGGVTLVVE
AAETLPDVDADRDRVLQVLGNLLADALQATEGGHVTVRARAVESGRAVAFEIEDSGRAIP
EEELAHFFDRYRRGRGASARGASLGLAVARGIVEAHGGRIWAESRSGQGSRFTFTLPAAA
PWQSRSAREVAGTR
Download sequence
Identical sequences A7HI83
404589.Anae109_4251 gi|153007088|ref|YP_001381413.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]