SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153007123|ref|YP_001381448.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153007123|ref|YP_001381448.1|
Domain Number 1 Region: 202-414
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 4.58e-23
Family Multidrug efflux transporter AcrB transmembrane domain 0.0093
Further Details:      
 
Domain Number 2 Region: 627-821
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 1.83e-21
Family Multidrug efflux transporter AcrB transmembrane domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|153007123|ref|YP_001381448.1|
Sequence length 845
Comment RND efflux transporter [Anaeromyxobacter sp. Fw109-5]
Sequence
MRPSERWVRFADRHRTAILAACAAVAVAGSVGTVRLYTDLRPDLAELLPESSKSAVDLEH
VTARVGGFAEQTVILSGADPLTMQLFADDLAEKLDEAPEELVRWVEYRVGEIVDFYRPRL
LLFPEKAELEELRDALAARIAWERANEAGAANGAAPDVEGLIARLGGERKELIGRFRDGY
TMGDVPVPGKPGEKMTILAMIVRLGSTPGDYGKVAALDRVVRETVKALDPKKYAPTLEVA
YGGYVTSTVMEHDALAEDLVWATILVILSVAASVAIYNRTWKSVPLVGIPLLAGTFATFG
IAELVVGHLNSNTAFLGSIVVGNGINVGLILFARYLEERRRGAGPIPAMQTAVGATWLAT
LTAALAAGVAYASLLSTDFRGFNQFGLIGGLGMALSWLFSYVMTPPLVLAWERRSPIPRE
GQRPSRPLFTLALSHVVERFPRLTTVVALAVSVASVGAVAHFADDALEYDFRNLRDVSAL
APGGPGWWDARVDDLFGEHLTPTALLARDEAQARELARRIEAHRRATPGSTIGSVVSVEA
FVPAGQEEKLPIVREIRALATRENLSFLPPDRRMAVEAVLPPEDLRPFAAADLPEELRRQ
LTETDGRVGTPVLVYPSGRIDVWNGRDVLRFTEELRGLDLPADAPIASSLMVFSDVLYAI
QADGPRATLLSLAGVVVLVLVAFGAGKRSVRSLADAGWVLAALGLGVLWFAGLAGAFELR
LNMLNFIALPITFGIGVDYATNVFQRRRLDHARSISDTLRTTGGAVALCSVTTVIGYASL
LVARNQALFSFGLLAVIGELACLATALLALPSVLRWREQRRREGPGANGGPAEREEGDVE
LRAVR
Download sequence
Identical sequences A7HIB8
WP_012099108.1.20576 404589.Anae109_4286 gi|153007123|ref|YP_001381448.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]