SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153007202|ref|YP_001381527.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153007202|ref|YP_001381527.1|
Domain Number 1 Region: 342-504
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 9.04e-44
Family Histidine kinase 0.0014
Further Details:      
 
Domain Number 2 Region: 277-353
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000000128
Family Homodimeric domain of signal transducing histidine kinase 0.0045
Further Details:      
 
Domain Number 3 Region: 151-276
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000349
Family Heme-binding PAS domain 0.017
Further Details:      
 
Domain Number 4 Region: 30-128
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000754
Family PYP-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|153007202|ref|YP_001381527.1|
Sequence length 514
Comment PAS/PAC sensor signal transduction histidine kinase [Anaeromyxobacter sp. Fw109-5]
Sequence
MGTTGDGSGRTLVPAPGDIARNAFGGITAAMFEAVFDASPAGLAVLVGPDLIVDHANAAC
RALTRADVDPVGQPFEDVWPTGDPAVLPALRNVLATGAGLCVDDYAVPAAGGVRRFCVQV
RRIPWRRGLAVLVAVWETSEAWAARRAAEEAAAAALTRAGELDATVDAIADGLVIYGRDG
EILRMNRAAMRQLGYDAGEASPSFAERFAALRVYAPDGRLMRLEDTPVVRALQGETVRSL
HARVEYQGRSLWVLASSAPVRGADGSIAGAVLTFSDETALHAMEQARDDLVRMISHDLRT
PLNAIYNQAHLLRRYPNDAARVEARAAAVLKSCERMSAMIQDLVEATLLEDGQLQISPEP
VDLAAAVPELLERFHGAIDVDRVRLVVHPDLPRALADPQRLERIVVNLLTNALKYSPPQG
EVVLELAPAPEGVAIVVTDRGVGIAPEDVPHVFDRFFRARGARQPEGLGLGLYITRHLVQ
AHGGRIEVSSRLGQGSTFRVVLPSADGNGVAALH
Download sequence
Identical sequences A7HIJ7
404589.Anae109_4365 gi|153007202|ref|YP_001381527.1| WP_012099188.1.20576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]