SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153007212|ref|YP_001381537.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153007212|ref|YP_001381537.1|
Domain Number 1 Region: 82-223
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 7.47e-27
Family Histidine kinase 0.018
Further Details:      
 
Weak hits

Sequence:  gi|153007212|ref|YP_001381537.1|
Domain Number - Region: 23-78
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00196
Family Homodimeric domain of signal transducing histidine kinase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|153007212|ref|YP_001381537.1|
Sequence length 246
Comment histidine kinase [Anaeromyxobacter sp. Fw109-5]
Sequence
MPRTPEDSATSLESLDAELLAPGLLHELRQPLMGADAAATLLERSLGPALEGAEEWRLLR
GQLARLGEIVNGYEGLLRPSAAPPAPFPVGAAVARAVELLAHRIRPLGPRFALARGPAGL
EGFGRPEALVHVATNLLSNALDAIEGVAGAPRIAVRVLAEGDHAVEVRVSDEGAGVPPEA
HPRLFEPRFTTKPPGKGTGLGLHLSRVLMAKNGGQVYLVPEEDPARLPWAVTEFCVLVRS
PAGGAR
Download sequence
Identical sequences A7HIK7
404589.Anae109_4375 WP_012099198.1.20576 gi|153007212|ref|YP_001381537.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]