SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153007298|ref|YP_001381623.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153007298|ref|YP_001381623.1|
Domain Number 1 Region: 346-528
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.81e-38
Family Histidine kinase 0.00000833
Further Details:      
 
Domain Number 2 Region: 529-660
Classification Level Classification E-value
Superfamily CheW-like 8.37e-27
Family CheW-like 0.00087
Further Details:      
 
Domain Number 3 Region: 5-124
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 1.96e-23
Family Chemotaxis protein CheA P1 domain 0.0033
Further Details:      
 
Domain Number 4 Region: 173-257
Classification Level Classification E-value
Superfamily CheY-binding domain of CheA 0.00000000000759
Family CheY-binding domain of CheA 0.0026
Further Details:      
 
Domain Number 5 Region: 280-343
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000102
Family Homodimeric domain of signal transducing histidine kinase 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|153007298|ref|YP_001381623.1|
Sequence length 662
Comment signal transduction histidine kinase CheA [Anaeromyxobacter sp. Fw109-5]
Sequence
MALDLQRYLGLFVSEAGEHLAAFGRELVRLEQVGQDGRKELVDGLFRRAHSVKGMSASMQ
LDGIAALAHGVEDLVAVFRADPARLDPAAVDLLLSAGDALQAMVQEAAKGARPEADEALV
ARVAEAARRRREGASPPPSPAVARSPPPRGAGEPPAEPGPDGSSLTHRPRAGGTRRVQVE
VEIAGSCPVPAVRAFLVVKKLGGLGAVAQARPSVEELRAGRIPGKRLEVQLETAETLQAL
ERALAQISDLAGVVLREVEAERAPVPPPAAREAGAAEASRTVRVRTEILDGFLDTVGELI
LATARIRELGRALPEGSRAALDEGVDRLHAIVKDLHDKVMTVRMTPLALVTEGLPRAARD
VARKLGKQVEVEIRGAEIELDRAILEELSDPLLHVLRNAVDHGLEAPHLRLLAGKPAAGT
ISVTARRERDRVIVEIADDGKGMDPEKLRAAAVARGALRAEEAGQLSDREALLLACLPGV
STAETVTDVSGRGVGLDAVKRTVEGVGGALELDSTPGKGSRVTFRLPLTVAVQPVLLVRV
GEEVLGVPIAKVHGAAQVSLSRLERSQGTPVLRHEDALVPVHELTRLLGFPGAPGDERAV
VIVEGGEAGRVGLAADALLGQHEAVLKPLGEPLELVPGLSAVTVLGNGRPVFILDVPRLL
AP
Download sequence
Identical sequences A7HIU3
404589.Anae109_4461 WP_012099289.1.20576 gi|153007298|ref|YP_001381623.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]