SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153002883|ref|YP_001377208.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153002883|ref|YP_001377208.1|
Domain Number 1 Region: 387-553,721-789
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 4.71e-88
Family Type II DNA topoisomerase 0.00047
Further Details:      
 
Domain Number 2 Region: 2-205
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.23e-63
Family DNA gyrase/MutL, N-terminal domain 0.00000108
Further Details:      
 
Domain Number 3 Region: 209-384
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.88e-48
Family DNA gyrase/MutL, second domain 0.00000646
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|153002883|ref|YP_001377208.1|
Sequence length 795
Comment DNA gyrase subunit B [Anaeromyxobacter sp. Fw109-5]
Sequence
MLEGLEAVRKRPHMYIGDVGERGLHHLVYEVVDNSVDEAMAGRANEITVTIHADSSITIV
DNGSGIPIGPHPSVKGMDTLDVVLTKLHAGGKFESNAYKVSGGLHGVGVTCVNALSEWLK
AEVYREGKVWLQRYDRGTPAGKVTAVGETQRRGTKITFKPDATIFEVTEFSFETLSGRLR
ELAFLNAGLTITIEDERSGKKHEFLFKDGIREFVGYLNKSRDVLFQPPISLRQEVETERG
TALVEIALQWNDGYDEKVFAFANNIHNHEGGTHLIGFKAALTRTINAYGQKNNLFKDLKD
ELPSGDDMREGLAAVISIRLPGASFEGQTKTKLSNTEAKSMVETMLNERLGAFLEENPNV
AKRVCAKVAEATRARIAARKARETVRRKGALDGASLPGKLADCQSRDPRESELFIVEGDS
AGGSAKQGRDRRTQAILPLRGKILNVEKARFDKMLSSAEIATMITALGTGIGPEEYDVSK
IRYHKIVIMTDADVDGSHIRTLLLTFFFRQMPELVEKGYLYIAQPPLYRVQKGKKESYLK
DEAALDDFLLQLGTEKAKLVAGDLVVEGADLKRLAQDAIRYRGLLARVDRRRDSRIVDAA
VQLGDLDLELLKHHEQVKEQVQKIFDKAQKLHPELEVRLAKIERDEEHGCDALVFQTTMS
GATRTTRIDFDYLSGPEWGELAGLYGELAELGAGPHKLRTGDGEEEVDDVFGAVEVLKRA
ATAGQTIQRYKGLGEMNPEQLWETTMDHARRTLLQVRVDDTVEADEVFSVLMGDAVEPRR
EFIEKHALDVQNLDI
Download sequence
Identical sequences A7H678
gi|153002883|ref|YP_001377208.1| 404589.Anae109_0004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]