SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153003343|ref|YP_001377668.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153003343|ref|YP_001377668.1|
Domain Number 1 Region: 376-559
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.36e-34
Family Histidine kinase 0.0000528
Further Details:      
 
Domain Number 2 Region: 707-829
Classification Level Classification E-value
Superfamily CheY-like 6.83e-33
Family CheY-related 0.0027
Further Details:      
 
Domain Number 3 Region: 7-122
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 2.75e-19
Family Chemotaxis protein CheA P1 domain 0.0071
Further Details:      
 
Domain Number 4 Region: 564-692
Classification Level Classification E-value
Superfamily CheW-like 5.1e-19
Family CheW-like 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|153003343|ref|YP_001377668.1|
Sequence length 830
Comment signal transduction histidine kinase CheA [Anaeromyxobacter sp. Fw109-5]
Sequence
MDRELFRQIWPVFSAEAREHLEGISAGILELERDPGRPVIDGVRRIAHSLKGSAGSLGLA
DLERLAHALEGSLAGYDPAAGLSRAAVQAALEAVEAMEAALASGDAGGVVEVPAVDALLV
GLGAAARIGQGPGTAARDEATLGPTGAAAASADVLAGMDALEAALEQLCAPLEPDARRAV
AGGAARGALHLAALAAPGVAALARRAADAFTLLAEGGPDAPRATAALAGDLIDLREALAR
APVAPAPAEAGPTGAAAAAKARGERSIRVLASTLDSIGRQFELLALAEARRARRARDVLG
HAEAVRGALQSLDHATRRLRGAGIETGRAELDSASTRLREVAAALGRVALEAQREAEAQR
LAGTVLREDLRGLRMVPAALVLEPLRRAVRDVAGRLGKEVELTVEGGEVRLDRQIVDALR
DPLLHLVRNAVDHGIEAPAARRDAGKPTGGRIAVRVEPRGARVAIVVEDDGPGLDVGAIR
AAAVRKGLLTTEEVDRLTDAEAARLVFHAGVSTARAVTEISGRGVGMDVVLETLARLQGT
IDVRWEAGRGTRFDLDVPLALSASAALVVRVGRDVVAVSADPIEHVVLLRDQDLGTVAGR
TTVLVAGEHVPYAPLARLLRSEEGGGPARQAVALVLAHGGARVAVGVDELVGQQELVISS
LGGLVAQIAHLAGAAVLDDGRVVGVLSAPELLRRAQPGAAAARAREGGRRVLVADDSLTT
RSAMKALLELAGYAVLPAADGEEALQLLREAGADLVVSDVQMPRLDGFGLARKVKADPRL
RRTPVILVTSLDAPEDRATGLAAGADGYLVKREVERGKLLDLVRQLLPRA
Download sequence
Identical sequences A7H7I8
WP_011984790.1.20576 404589.Anae109_0469 gi|153003343|ref|YP_001377668.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]