SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153003673|ref|YP_001377998.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153003673|ref|YP_001377998.1|
Domain Number 1 Region: 283-452
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.31e-43
Family Histidine kinase 0.0021
Further Details:      
 
Domain Number 2 Region: 593-710
Classification Level Classification E-value
Superfamily CheY-like 7.54e-25
Family CheY-related 0.0062
Further Details:      
 
Domain Number 3 Region: 209-295
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 2.16e-20
Family Homodimeric domain of signal transducing histidine kinase 0.0033
Further Details:      
 
Domain Number 4 Region: 471-587
Classification Level Classification E-value
Superfamily CheY-like 2.7e-16
Family CheY-related 0.0022
Further Details:      
 
Domain Number 5 Region: 42-139
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.00000000000537
Family Histidine kinase 0.045
Further Details:      
 
Weak hits

Sequence:  gi|153003673|ref|YP_001377998.1|
Domain Number - Region: 162-228
Classification Level Classification E-value
Superfamily FlgN-like 0.0445
Family FlgN-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|153003673|ref|YP_001377998.1|
Sequence length 718
Comment histidine kinase [Anaeromyxobacter sp. Fw109-5]
Sequence
MSARAAAPGAPLLTIAVRREEDVVLARQRARQVARLVGIASSEQTRLATAVSEIARNAWK
YAGGGKVEIALEPDEEEGSALVVRVRDRGGGVTELDAILAGRYRSPTGMGLGISGSRRLV
DRFDIQTGPSGTTVTLAKLLPPGSGPATPRELAAVVEELQRERPHDALEELTSQNQELLR
TLDALRERERQLVAVNRELEDTNRGVVALYAELDEKADYLRRASELKSRFLSNMSHEFRT
PLNTVISFCRMLLDETDGPLNDEQRKQVGFARRAAEGMLDLVSDLLDLAKVEAGKTTVRS
SPFEASELFGALRGMLRPLLATTQVTLHFEDPVGLPTLYTDEGKISQILRNFISNALKFT
ERGEVRVSARRQGDRVVFSVSDTGIGIAREDLDRIFQEYGQLDSPVQRRVRGTGLGLPLS
KRLAELLGGRLAVKSEPGVGSTFSLEVPLLYGGPPEIGTVADVCALHDPTRYPVLVVEDN
PETIFAYEKYVRGTPFQVLPVGTLPEARHAVQRLRPIAVVLDVMLGAEAAWPLLSELKGS
ALTRGIPVYVVTMVENRGKAKGLGADDFSEKPLERAWLLSRLETAAALLPREEVVVVDDE
EASRYLLRSLLEETRYAVQDASSGEEALALVAERRPAAVFLDWKMPGMDGGEVLARLLAD
PQTRDVPVIVYTGEELGPEQRARAGGAAAILGKGRPRASALQEIREALARLAGGVTRS
Download sequence
Identical sequences A7H8G8
gi|153003673|ref|YP_001377998.1| WP_011985120.1.20576 404589.Anae109_0803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]