SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153003928|ref|YP_001378253.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153003928|ref|YP_001378253.1|
Domain Number 1 Region: 286-524
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.44e-71
Family Extended AAA-ATPase domain 0.00000115
Further Details:      
 
Domain Number 2 Region: 130-257
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.22e-28
Family Heme-binding PAS domain 0.051
Further Details:      
 
Domain Number 3 Region: 498-594
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000222
Family FIS-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|153003928|ref|YP_001378253.1|
Sequence length 602
Comment sigma-54 dependent trancsriptional regulator [Anaeromyxobacter sp. Fw109-5]
Sequence
MQQTTDDVRRLQGSIDDLIGVLAPLALWSGQAPAHLVDRLIEVLARLLRLDFAYALPEDE
GGAPHVEWARLAPAGGSTCSRDVAANQAAIGLQETRHLGEQERVARELDHRVAQRTRELA
AANEELRREIGERRRMEEKLRQDERELRRITDVIPQAIIVLAPDGTMLHANAFVLEYTGL
SLGDIKAAGARGSIFHPDDVEKLWDERQRALSRGEPFELELRARRKDGRYRWFLVRYVPF
RDERGRLTRWYATGTDIEDRKRAEEKVRNENLALRGEIDGSSMFEEIVGSSEGLRRVLAQ
VAKVAPTDSTVLILGETGTGKELIARAIHRQSSRSTQAFIRVNCAAIPSSLITSELFGHE
KGAFTGAVQRRTGRFESANGGTIFLDEVGDLTAETQIALLRVLQEREFERIGSSRPISVD
VRVLAATHRDLEAAVEAGTFRQDLFYRLNVFPLQIPPLRERRDDIPLLAEYLIARYARTA
GKSIRNIGKRTLESFRAYDWPGNVRELQNVVERAVILCDGETFAVDETWLTRETSAPAGR
SVSLAGSLADSERQMIEAALAASRGRVSGPSGAAIRLGIARQTLESRIQALHIDKYRFKS
PS
Download sequence
Identical sequences A7H973
gi|153003928|ref|YP_001378253.1| 404589.Anae109_1061 WP_011985375.1.20576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]