SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153004413|ref|YP_001378738.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153004413|ref|YP_001378738.1|
Domain Number 1 Region: 49-278
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-61
Family Protein kinases, catalytic subunit 0.000073
Further Details:      
 
Domain Number 2 Region: 540-714
Classification Level Classification E-value
Superfamily TPR-like 3.18e-23
Family Tetratricopeptide repeat (TPR) 0.0099
Further Details:      
 
Weak hits

Sequence:  gi|153004413|ref|YP_001378738.1|
Domain Number - Region: 491-523
Classification Level Classification E-value
Superfamily TPR-like 0.00253
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|153004413|ref|YP_001378738.1|
Sequence length 784
Comment protein kinase [Anaeromyxobacter sp. Fw109-5]
Sequence
MALRDEGDGLGTSEGTVREGGAAVTALLAQLAAASSDEPPPSLTPGTHVGRYEIIRLLGR
GGFGFVYEAHDTDLHRLVALKVLNPSRVRRSGVPSEGEAAARLTHPNIAALHDAGTVGGA
PYLVYELLHGETLESRLARGPLRATDAVSVAIGIAGALAHAHAQGVVHRDLKPANVFLTA
DGDVKVLDFGIALLFGREGPSGGTPTYMAPEQRRGEPEDARTDLYALGLVLAEMITGARA
GSTPAADRRIPAPTRRVMAALLAEDPAARPRSARTAIAALEGARRAAGAPRKARRRALVV
LAGLAMVSALAATLLLRDRPPRRASAAPSAPSIAVMPFADLSPEKDQEYFSDGLAEEILN
ALARIEGLHVAGRTSSFSFKGKTDDVAAIAAKLHVTSLLEGSVRKAGSRVRITAQLLDTK
NGYHLWSQTYDRELTDVFVVQEDIARSVVEALRAKLVPAATARISARGTANAAAYDHYLI
GRELRRHPSPGSWRRAIAAFERAVALDPGYASGWAELGNAWFWYANERSRIEEVDDGKRR
AAEAVERAIALAPTLGEAYAVRGTIRAAEQRWSEALADMDRAVSLNPGSADVYWLRGQFL
LGPLGRYDAAVEDMRRTADLDPLWPLAWGGLGAALLARDERAEALRMFERAVELNPGADI
GRHMIVVTLLLDGRAAEAIPLLERPRSPWRLQDEALVYHALGDRPRSQRALDALIAEAAG
AAAFQIAEVYAWRGERARAFYWLDRAFAQRDAGVSDLLASPLLEAVRDDRRYAAAVARLK
LPPR
Download sequence
Identical sequences A7HAK8
gi|153004413|ref|YP_001378738.1| 404589.Anae109_1549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]