SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153005403|ref|YP_001379728.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153005403|ref|YP_001379728.1|
Domain Number 1 Region: 527-676
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.44e-38
Family Histidine kinase 0.0053
Further Details:      
 
Domain Number 2 Region: 701-820
Classification Level Classification E-value
Superfamily CheY-like 2.28e-26
Family CheY-related 0.0055
Further Details:      
 
Domain Number 3 Region: 53-155
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.65e-17
Family Heme-binding PAS domain 0.062
Further Details:      
 
Domain Number 4 Region: 196-327
Classification Level Classification E-value
Superfamily GAF domain-like 4.14e-16
Family GAF domain 0.0084
Further Details:      
 
Domain Number 5 Region: 329-437
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000531
Family Heme-binding PAS domain 0.044
Further Details:      
 
Domain Number 6 Region: 448-526
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000186
Family Homodimeric domain of signal transducing histidine kinase 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|153005403|ref|YP_001379728.1|
Sequence length 823
Comment multi-sensor hybrid histidine kinase [Anaeromyxobacter sp. Fw109-5]
Sequence
MALSTTPELLRELAILYHRVAELERVGGLRPGEGAPEGLQRRVDDLGAGLHAALAAFSDD
LLGVLTPAGDLLFVNDAVERLVGYRADEVIGKNAWSFVDEEDLASLASARSTPLDDAIPI
EIRVRCADGRLRWFEFSARPWPRDNPVYIVARWRDAQGRREPASREDDARRLDAELRRAA
ALARVSQLALGLPSVQDVLDAAASLAPSALQLEAGAYLEPEGGGLVVRAAAGIPVPRGHA
VPVVMTLAGLARAGGAPVHSADVVRDGRLADSLLAAAGASSAIAVPVRGKERAHGVLLVA
GRTSRHFAPDEIHFLETVANVVATSVDGRAAQEAMRGRERLARAVFDHARDGLAIVDAEG
RCLDANAAAEQILGTTFDALRGHRPAEVVRTDLDLAPRSPRQGEATVTTASDTRLVEWDV
VPDIQPGVALAMLRDVTSKREIATRLALADRLISVGALAAGVAHELNTPLAYVAANLEYL
AGAVPPLLVERAGAEIREALQESVEGVERLGLILQDLRTFARPAAGDDDGPANLEAVLRS
SVAMTWNEIRHRARLEKDVRRVPPVHGSPARLAQVFVNLLANAAQAIPEGDAQSHVIRIS
AREQPGGRVAVEVADTGSGISPAVLPRIFEPFFTTKVAGQGTGLGLSICRSIVQGLDGHI
EVRSAPGNGTMFRVLLRAADVQPAASFGRGPGRAPAPAVPRSSVLVVDDERLIAASLRRV
LAADHDVTVVSSARSALRLVERGERFDAVLTDLVMPDMTGLELHRQLLTLAPELERRVLF
MTAGAFTEEARRATEIAPDACLEKPVRIDVLRAALARVIGARG
Download sequence
Identical sequences A7HDE8
gi|153005403|ref|YP_001379728.1| WP_012097338.1.20576 404589.Anae109_2543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]