SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153005788|ref|YP_001380113.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153005788|ref|YP_001380113.1|
Domain Number 1 Region: 315-483
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.96e-42
Family Histidine kinase 0.0014
Further Details:      
 
Domain Number 2 Region: 502-621
Classification Level Classification E-value
Superfamily CheY-like 5.12e-34
Family CheY-related 0.005
Further Details:      
 
Domain Number 3 Region: 250-327
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000112
Family Homodimeric domain of signal transducing histidine kinase 0.0017
Further Details:      
 
Domain Number 4 Region: 13-119
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000593
Family PYP-like 0.036
Further Details:      
 
Domain Number 5 Region: 160-255
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000279
Family N-terminal PAS domain of Pas kinase 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|153005788|ref|YP_001380113.1|
Sequence length 623
Comment PAS/PAC sensor hybrid histidine kinase [Anaeromyxobacter sp. Fw109-5]
Sequence
MRSNGGTAADGLADALFEEAGAGLCLVSASGKVLRANREWLRVTGHLEGEALGREVAELL
PWDRALSRALDEPLSAGERRELPRRPRRVNGREVWWEGRVTGVALEGGTGRLLALRDVTA
EAVPGPFRDAGARYRRLFDELREHVFVYTVVRDGAGLVIDWILADANHQALALLGAPLER
VAGRRASELFGAAALAEQLAASREVMATGRGLTFERRFAWDGRHYLTSLFPLDHWNLVAA
GIDTTERVAAEEALRAEDRRKSEFLAMLSHELRNPLAPMRTAVAVLERAAPGAPEASRAR
AAITRQTEHLARLVDDLLDVTRIAHGKIRLRTERLDLAALVRCTADDHRDLLAASGVALR
VTGAVEPLPILGDRTRLEQVVGNLLANAGKFTRRGGNVTVTLGRERDRAVFSVADDGEGI
DPELVPRLFAPFVQADDGLDRPRGGLGLGLYLVRSLVELHGGSVAVRSGGSGRGAEFTVG
LPLVEEARAPEPTRDPLSGKGPRRVLVIEDNPDAAEMLRDLLAGAAHEVEVAPDGRQGVA
RARALRPDLVLCDIGLPVMDGYEVARTLRGDPDLSATLLVALSGYAMPDDVAKAAQAGFD
RHLAKPVSLSELGAVLAAAARSV
Download sequence
Identical sequences A7HEI3
gi|153005788|ref|YP_001380113.1| 404589.Anae109_2929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]