SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|153006868|ref|YP_001381193.1| from Anaeromyxobacter sp. Fw109-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153006868|ref|YP_001381193.1|
Domain Number 1 Region: 449-567
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000244
Family Heme-binding PAS domain 0.065
Further Details:      
 
Domain Number 2 Region: 397-445
Classification Level Classification E-value
Superfamily HAMP domain-like 0.000000929
Family HAMP domain 0.007
Further Details:      
 
Weak hits

Sequence:  gi|153006868|ref|YP_001381193.1|
Domain Number - Region: 248-305
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00122
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|153006868|ref|YP_001381193.1|
Sequence length 579
Comment putative PAS/PAC sensor protein [Anaeromyxobacter sp. Fw109-5]
Sequence
MTLKLKLQLAISVAVLVTAVVVAGYAVGSLRSQAAADVARIRAEKTAQVKQDLADKVNTV
YALIDAQYREAADERYLEQKYGQRLEAILDVAGATLREHLERARRGEVPVARAQAEALAT
LRAMRFDGGKGYLWINTVGRPYPTMLMHPLVPRLEGTVLDAPEFDCAGDANRNLFQLAVE
LTAARGEGFIRYSWPEPDGNALLPQMPKFSYVRLFKEWGWVVGTGIYVDEAVREKLAEIT
SGIRKIRYGSEYFWISTAESPVPRMVMHPIRPELDGQRMDAKEFELVVNGRAQNLFSAFR
DLSSKDGEGFVEYTWPKPTAAGAPGPAAPKVSFVKRYRPLDWIIGTGRYVDDIEVAIAEK
TAAAEEQVGALVRRIMLASLVVVVLAVAGVSFLAATLTKPLAKLVGLSRDIAEDEKHLSR
RIGLRSRDEIGQLATEFDHMAERVEASFRNVREQRELLLSVLSNVPHSIYWKDRRSVYLG
CNDRFAQRFGLPSTEAIVGKTDAQLGWSDEQRARLAAGDRRVMDEGAPLLDEREHLRDAS
GRDIDCLASRVPLRDQAGNLIGMLGVFVAIPPDDRALSA
Download sequence
Identical sequences A7HHL3
gi|153006868|ref|YP_001381193.1| 404589.Anae109_4031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]