SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|119952539|ref|YP_950017.1| from Arthrobacter aurescens TC1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119952539|ref|YP_950017.1|
Domain Number 1 Region: 32-165
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.31e-28
Family Glutathione peroxidase-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119952539|ref|YP_950017.1|
Sequence length 173
Comment thioredoxin family thiol:disulfide interchange protein [Arthrobacter aurescens TC1]
Sequence
MAEKVNAGTNSYVAGDGSVAEYAADIRGETVRFSGQLFDGTTLANDDWAGQVTVLNVWYA
ACAPCRVEAPDLSALHSEFEPQGVKFYGINTRDEAPTAEAFERSFGIEYPSLKDKNGKIL
LALTDYVPPQAVPTTLVLDKEGRVAARILGIAEKSTLKAIIQDALTAPDPEKP
Download sequence
Identical sequences A1RCQ5
gi|119952539|ref|YP_950017.1|NC_008712 gi|119952539|ref|YP_950017.1| 290340.AAur_pTC10145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]