SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|119961186|ref|YP_948748.1| from Arthrobacter aurescens TC1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119961186|ref|YP_948748.1|
Domain Number 1 Region: 4-103
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.54e-29
Family Thioltransferase 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|119961186|ref|YP_948748.1|
Sequence length 125
Comment thioredoxin [Arthrobacter aurescens TC1]
Sequence
MATVDITGEQFASTIEDNDIVLVDFWAAWCSPCRQFAPTYGAASEKHTDVVFAKVDTEAE
QQLAAEAGITSIPTLMAFREKVLVFSQPGALNGPQLEQVIEAVKGLDMEEVHAHVAKARA
EAQEN
Download sequence
Identical sequences A0A1H6QSA5 A1R936 J7LYH2
gi|403528227|ref|YP_006663114.1| gi|119961186|ref|YP_948748.1| 290340.AAur_3045 WP_011775683.1.100148 WP_011775683.1.67142 WP_011775683.1.8087 WP_011775683.1.83037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]