SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|119962002|ref|YP_946492.1| from Arthrobacter aurescens TC1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119962002|ref|YP_946492.1|
Domain Number 1 Region: 1-210
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.75e-47
Family Thioltransferase 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119962002|ref|YP_946492.1|
Sequence length 232
Comment DSBA-like thioredoxin domain-containing protein [Arthrobacter aurescens TC1]
Sequence
MKIEIWSDVACPWCYIGKRRFETALAQFPHRDSVDIEWKSYQLDPSVPEHYDGTELDYLS
NRKGMAPEQVKQMFAHVTETAKGEGLDYHFDKVVVANSFTAHRLIHLAASHGRQDAAKEQ
LLSDHFEHGKDIGNQEYLTELGASLQLPADEVAELFTSDKYTDAVNQDINEARAIGVTGV
PFFVIDRKYGISGAQPADLFSQALNQAWQEANPLIPVGASDAEACGPDGCAV
Download sequence
Identical sequences A1R2N0 J7LQA4
290340.AAur_0689 WP_011773440.1.67142 WP_011773440.1.83037 gi|119962002|ref|YP_946492.1| gi|403525738|ref|YP_006660625.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]