SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150398981|ref|YP_001322748.1| from Methanococcus vannielii SB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|150398981|ref|YP_001322748.1|
Domain Number - Region: 140-207
Classification Level Classification E-value
Superfamily VPS9 domain 0.0981
Family VPS9 domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150398981|ref|YP_001322748.1|
Sequence length 209
Comment CRISPR-associated Cas4 family protein [Methanococcus vannielii SB]
Sequence
MKSSQNSFNNFEGFNENEYYITPSEMLEFLYCKRYTYFMNYLGISQHEEKRYKVLKGRTI
HEKKELENANYLRKKINVVDKKINVSMVSKNYGIKGIADEVLTLSNGTMASLDYKFAEYN
DIIYKTYKMQTIMYSLMIAETFNAEVTQGYILYCRGKNVLKEIEVNIKEINKLNKYLEEF
KKVMSGHYPKSASNKLKCIDCCYKNICVK
Download sequence
Identical sequences A6UNR4
WP_011972039.1.66029 406327.Mevan_0227 gi|150398981|ref|YP_001322748.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]