SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150400369|ref|YP_001324136.1| from Methanococcus vannielii SB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150400369|ref|YP_001324136.1|
Domain Number 1 Region: 162-274
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000934
Family Calponin-homology domain, CH-domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150400369|ref|YP_001324136.1|
Sequence length 372
Comment hypothetical protein Mevan_1632 [Methanococcus vannielii SB]
Sequence
MADIKTHLRELSVIAGILYTISEKNINELYQMHPKDFFKYLSSKISNDISNASNITYLPD
FNNYKSIMCNGINLGKKIVDLGIVDDYTKIYWLGSDSQKNDPVDLKVGNTGFSLKEESYI
LENMGLYKYLNTMTNSKFERGLHIFENFAEAEYAKWFEYTWNSMLGWLKTNNNIWSLTKN
DKTSEIKIVNSEVQFIINGTVISKLPNRNISVKEYIEHTDSKSREKVFSKWINSKFKKDK
KYIDLKNICSQKAGSELCNYISRNYNPVGLARFLQIYENGYYYAKTTEKDIEIYYVPSIS
EFEKDIEIDKIEYSIPKSQLNIITTVKNKITGNSLEFRNECRFSHGQFNGTPEAKMYYGR
NTDLSDIYEKKY
Download sequence
Identical sequences A6USQ2
gi|150400369|ref|YP_001324136.1| 406327.Mevan_1632 WP_012066438.1.66029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]