SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150400423|ref|YP_001324190.1| from Methanococcus vannielii SB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150400423|ref|YP_001324190.1|
Domain Number 1 Region: 434-536
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.51e-16
Family Anti-sigma factor antagonist SpoIIaa 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150400423|ref|YP_001324190.1|
Sequence length 552
Comment sulfate transporter [Methanococcus vannielii SB]
Sequence
MKLNQNIKFENIRADLFAGTTVAIVALPLAMAFAIASGVSPEKGLFTAIIAGLLISLFGG
SKYQIGGPTGAFVVILYSIVVTHGYEGLVIATIIAGLLLILMGILKLGSIIKYIPYPVTM
GFTSGIAVIIFSSQIKDFFGLSLESVPAKFIDQWFLYISHISSINPYALILSLISVVLII
HSKKIVKNIPGPIIAIIASILLVNIFNLPVETIESKFGQIPNVIPMPMIPEITLEKIEHL
FPSALSIAFLGAIESLLCAVVADGMTGDKHKSNKELIGQGFANIFSVIFGGIPATGALAR
TATNIKAGATSRISGITHAVMLFVFMLILAPLIIKIPLATLSAILVIVAWNMSEIKHFKS
ILFTAPKRDSLVLLVTFLLTVFINLNVAIQAGMVLAVLVFIQRLIEVSEISKVSKLSPEE
DPHSITLKDVPPCIEVYEVNGPFFFGIADKFKSTLDVVTKRKPTAIILRMRHVPIIDATG
IKNFEEFVESCKKQNIELIISGANEILTHKFEKCGLTEKIGKEHFCENIDTALEFAKKVV
KKRHPELNACPK
Download sequence
Identical sequences A6USV6
406327.Mevan_1686 WP_012066491.1.66029 gi|150400423|ref|YP_001324190.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]