SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|152964156|ref|YP_001359940.1| from Kineococcus radiotolerans SRS30216

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152964156|ref|YP_001359940.1|
Domain Number 1 Region: 69-200
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 3.4e-21
Family GntR ligand-binding domain-like 0.019
Further Details:      
 
Domain Number 2 Region: 6-66
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000575
Family GntR-like transcriptional regulators 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|152964156|ref|YP_001359940.1|
Sequence length 222
Comment GntR family transcriptional regulator [Kineococcus radiotolerans SRS30216]
Sequence
MPDGPYETLRAAILGFDLVPGEKLSERGLEDLLGASRTPIRAALVRLENEGLTGRVGRGW
QVTPIDLTEVRAVVEHREAVETAAVALAVERATEEELLAVRALVEESAADDGPSGLRDGA
DFHVALARLSRNRFLADAVGGALVRLARTRWLEVRSPRSRATARAEHLGIVDAVLARDAP
TAVDLVTAHGRGAADRLLAHLAEERRRLRGRGFAIVETPPQP
Download sequence
Identical sequences A6W4D7
266940.Krad_0185 WP_012085501.1.7041 gi|152964156|ref|YP_001359940.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]