SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|152964340|ref|YP_001360124.1| from Kineococcus radiotolerans SRS30216

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152964340|ref|YP_001360124.1|
Domain Number 1 Region: 54-320
Classification Level Classification E-value
Superfamily NHL repeat 2.62e-33
Family NHL repeat 0.00013
Further Details:      
 
Domain Number 2 Region: 402-513
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000054
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 3 Region: 335-418
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000942
Family Cadherin 0.058
Further Details:      
 
Weak hits

Sequence:  gi|152964340|ref|YP_001360124.1|
Domain Number - Region: 533-562,590-630
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.0616
Family Mycolic acid cyclopropane synthase 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|152964340|ref|YP_001360124.1|
Sequence length 841
Comment fibronectin type III domain-containing protein [Kineococcus radiotolerans SRS30216]
Sequence
MTPDTRPTTAARRLRRTATWLLAMSLPAAAVAGGASAGAAAPVADYHATPLVTAGETYGA
PAGVAVAADGTVYFSDPGDHTVKRIGAGGSVSVVAGAAGGLSAPAGLAFGPDGGLYIADP
GADVVFKLVLPGTLTPVVGSGAQGPAKIGPAKDSPLHDPTGVVVAPDGTLYVADSENNQV
EKVTASGALTIFAGTGFAGSPQAGDANKSPLASPTGVALDAAGNLHVADADNHVVEKITP
TGTLSVLASTGSTGSTGRTPTSLAVDLAGTVYATDPAAGTVKRITSAGSVSTLSTDGTYG
RPNGVTTNPSGTIWLADGGSSPQVWALTSTADPGAPRVTSTPVTTAAVKVPWTYRATASG
TPTPTWSLLSDAPAWLKVSSGTGVFSGTPDAVGPITFTLRATNATGHDDQVVTLTVGALP
AAPTAPTAVAGDGRAVVTWTAATSTPAAPPVTGYVVTPHKDGVAQTPVTFTTAQATSQVV
AGLVNGAKYTFTVAATNSFGTGTASAASAAVTPYATSKRPVLDTAVSRLSGTDRLQTAVN
SSKALFPTSGSAGAVVVSAGYKYADALAGARLASATSAPLLLTASDKLTDAVGKEILRVL
APGGTVYVLGGSGTVSAGVQTALAALSPNFTVQRLAGDDRFETAARIAAEVAVQAPGTAT
APIYLASGVNFPDGLAVSALAARTGGVLLLTDGPVLPEATKAYLAAHDATGSRVVPVGGP
AAAAAAALPAAGGSAARAVVGVDRFDTARRVSDRFAAGTATRAAGVATGDNWPDALVGSA
AMGLLGGPLLLTSGPDLSNSARSALTTLNAAKPLATGVVFGGEPSVPARAGTAFGSYIAQ
D
Download sequence
Identical sequences A6W4X1
WP_012085312.1.7041 266940.Krad_0370 gi|152964340|ref|YP_001360124.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]