SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|152964506|ref|YP_001360290.1| from Kineococcus radiotolerans SRS30216

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152964506|ref|YP_001360290.1|
Domain Number 1 Region: 104-238
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.07e-25
Family GntR ligand-binding domain-like 0.00019
Further Details:      
 
Domain Number 2 Region: 40-116
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.88e-19
Family GntR-like transcriptional regulators 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|152964506|ref|YP_001360290.1|
Sequence length 245
Comment GntR family transcriptional regulator [Kineococcus radiotolerans SRS30216]
Sequence
MLRSCYVLPRRRRSGGSLPTYDDPVSAEPIPDTGREDGTLAELLSARIAAGEFRPGRRLS
EAELAERFSVSRNTLREAFRVLAEQGLLEHVPHRGVSVTAPRVADVLDIYRVRRHLETGV
LVKAAPRHPATARMRGAVEAAEAAAAAGDWAGVGTANMAFHAALVSLSDSPRLGRTYRQL
SAELRLAFLVIGDPQALHGAFVERNRSVLETFVADGGPAAARELEDYLTESERTVLGAYA
RLGLG
Download sequence
Identical sequences A6W5D7
WP_012085137.1.7041 gi|152964506|ref|YP_001360290.1| 266940.Krad_0537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]