SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|152965808|ref|YP_001361592.1| from Kineococcus radiotolerans SRS30216

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152965808|ref|YP_001361592.1|
Domain Number 1 Region: 16-269
Classification Level Classification E-value
Superfamily Cgl1923-like 9.42e-85
Family Cgl1923-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|152965808|ref|YP_001361592.1|
Sequence length 294
Comment hypothetical protein Krad_1842 [Kineococcus radiotolerans SRS30216]
Sequence
MPEQPVDPRAESAPAPVVLRDPVVIAAFEGWNDAGEAASQALAHLHEVWGAVDLVEFDPE
LYHDFQVNRPTVHYDDDGRRRLTWPTTRVSYALLPDAPRDVLLVRGIEPSMRWRTYAREV
VEQAQAHGASLVVTLGALLADVPHTRPLPITSSSEDPDLAEKLDVEPSRYEGPTGIVGVV
QDAVATAGIASLSLWAAIPHYVGQPPSPKGTLALLRRVEELLDLAVPLADLPEDARAWER
GVDELAAEDSEIAEYVQQLEEAKDTAELPEASGEAIAREFERYLRRRDDPPRRG
Download sequence
Identical sequences A6W939
gi|152965808|ref|YP_001361592.1| WP_011981533.1.7041 266940.Krad_1842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]