SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|152966446|ref|YP_001362230.1| from Kineococcus radiotolerans SRS30216

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152966446|ref|YP_001362230.1|
Domain Number 1 Region: 84-215
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 7.06e-27
Family GntR ligand-binding domain-like 0.0082
Further Details:      
 
Domain Number 2 Region: 14-102
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000824
Family GntR-like transcriptional regulators 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|152966446|ref|YP_001362230.1|
Sequence length 240
Comment GntR family transcriptional regulator [Kineococcus radiotolerans SRS30216]
Sequence
MTVNADLNVDAFATKSDFAYTRVRELILSGQLEPGAVIHQAALARRIGISTTPLREALRR
LKQQGLVELDAHRDARVSALDATEARDLLEMRRSLDPLAAALAAERRTKAELAEMRAALE
GLDALPGKPTWDQLAHHRRFHTAIYRASHNAILIESLDGLWDTADRYRLHGLQVERSEQE
RAMKAGEHHQLLEAITAGDAEGASQVMFAHIETSLGAKSAWRLAKPHSPELPTSTAVAQG
Download sequence
Identical sequences A6WAX7
266940.Krad_2490 WP_012087819.1.7041 gi|152966446|ref|YP_001362230.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]