SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|152966997|ref|YP_001362781.1| from Kineococcus radiotolerans SRS30216

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152966997|ref|YP_001362781.1|
Domain Number 1 Region: 21-252
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.12e-49
Family Extended AAA-ATPase domain 0.000000379
Further Details:      
 
Domain Number 2 Region: 258-331
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.98e-19
Family Helicase DNA-binding domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|152966997|ref|YP_001362781.1|
Sequence length 355
Comment Holliday junction DNA helicase RuvB [Kineococcus radiotolerans SRS30216]
Sequence
MEDRLVTTGADERERAAESALRPHGLDEFVGQKVVREQLALVLDAAKARGMPSDHVLFSG
PPGLGKTTLAMIVASEMGAPLRQSSGPAIQHAGDLAAVLSSLDEGEVLFLDEIHRMARPA
EEMLYIAMEDYRVDVVVGKGPGATAIPLELPKFTLVGATTRAGLLPAPLRDRFGFTGYLD
FYTPEELVKVLRRSASLLGVQLTAEGAAEIGGRSRGTPRIANRLLRRVRDWAQVRGSGIV
DRHAARAALEVYEVDERGLDRLDRAVLDALCRRFGGGPVGLSTLAVVVGEEAETVETVAE
PFLVREGLLGRTPRGRIALPDTWAHLGLTPPRDAPVGAAWQLPLDAEDAPGAEDS
Download sequence
Identical sequences A6WCH8
266940.Krad_3053 WP_012087232.1.7041 gi|152966997|ref|YP_001362781.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]