SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|152967586|ref|YP_001363370.1| from Kineococcus radiotolerans SRS30216

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152967586|ref|YP_001363370.1|
Domain Number 1 Region: 85-222
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 2.62e-26
Family GntR ligand-binding domain-like 0.017
Further Details:      
 
Domain Number 2 Region: 12-82
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000165
Family GntR-like transcriptional regulators 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|152967586|ref|YP_001363370.1|
Sequence length 239
Comment GntR family transcriptional regulator [Kineococcus radiotolerans SRS30216]
Sequence
MSSRVALPAAPARESLADSVHASLLTWLMDGGAAPGSPLSIDGLARDLGVSPTPVREALV
RMESTGLVERAAMRGYRVAGMLSREEIDQLMDARLLLECHNVALAAQRVEEDLLVRLSAT
VERMAVAPRGPSFADYRDYHQADNEFHRLLNRAGGNGFLADAFEGLNGQLQRFRLRALGQ
GVTDADLAVAEHVAVVDALRVRDGDAAAARMREHLEAVRSRALDDRAAAGLDAAPEPAP
Download sequence
Identical sequences A6WE67
266940.Krad_3643 gi|152967586|ref|YP_001363370.1| WP_012086630.1.7041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]