SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|152967836|ref|YP_001363620.1| from Kineococcus radiotolerans SRS30216

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152967836|ref|YP_001363620.1|
Domain Number 1 Region: 124-254
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.41e-20
Family GntR ligand-binding domain-like 0.011
Further Details:      
 
Domain Number 2 Region: 31-100
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000851
Family GntR-like transcriptional regulators 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|152967836|ref|YP_001363620.1|
Sequence length 262
Comment GntR family transcriptional regulator [Kineococcus radiotolerans SRS30216]
Sequence
MRSGDTCTEEAGQYGDVPDPTPQPRADSPRDGGPYDRVLERLGRRVVDGELPPGTVLALE
GIAAEHGVSRTVAREVVRVLESLNLLVSRRRVGVVVRPREQWTVLDPRIVRWRLAGPGRQ
AQLLALSELRLAVEPVAAALAARHATPEQCGALVEAVVGMTVTARTPDLTAYLQHDARFH
RTLLGATANDAFAALAGTLTEVLAGRTEHRLMPARPAAQAIAWHREVAEAVSVGDADAAE
DAMRSIVREATAAMAAASAPGA
Download sequence
Identical sequences A6WEW7
266940.Krad_3893 WP_012086362.1.7041 gi|152967836|ref|YP_001363620.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]