SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|152967955|ref|YP_001363739.1| from Kineococcus radiotolerans SRS30216

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152967955|ref|YP_001363739.1|
Domain Number 1 Region: 3-109
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.09e-18
Family LysR-like transcriptional regulators 0.0081
Further Details:      
 
Domain Number 2 Region: 83-283
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.00000000000000217
Family Phosphate binding protein-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|152967955|ref|YP_001363739.1|
Sequence length 284
Comment LysR family transcriptional regulator [Kineococcus radiotolerans SRS30216]
Sequence
MDLDLGQLRALAAVVAEGTFEAAARVLHVTPSAVSQRIRALETSAGRVLLVRVKPVVPTE
AGRTVLRLAREVELLAADARRELGQEEGTPVLPVAVNADSLATWFLGAVAPLAGEFCFDL
RREDQERTGELLREGGVVAAVTAEADPVPGCSATRLGAMHYQPCASAAFARRWFPRGVDR
EALSRAPVVVFDRDDDLQDRWLRGFGHPLPPRHHVPATSDFGEAVRRGFGWGMLLPAQVE
ACGPDGVVDLDPGGGVDVELHWQRWKIRSAALDRLSEAVLAAWR
Download sequence
Identical sequences A6WF86
WP_012086238.1.7041 266940.Krad_4012 gi|152967955|ref|YP_001363739.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]