SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|152968140|ref|YP_001363924.1| from Kineococcus radiotolerans SRS30216

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152968140|ref|YP_001363924.1|
Domain Number 1 Region: 114-243
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 2.88e-26
Family GntR ligand-binding domain-like 0.0099
Further Details:      
 
Domain Number 2 Region: 20-100
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.31e-19
Family GntR-like transcriptional regulators 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|152968140|ref|YP_001363924.1|
Sequence length 246
Comment GntR family transcriptional regulator [Kineococcus radiotolerans SRS30216]
Sequence
MPSEPPAGVADPAPARTPPPPPSQTDVVVEGIKSMIFDGTLGPGQRLPVEADLARTLGVS
RGPLREGVRALSHLGVLETRQGAGTYVTALDPSLLLAPMAFLVDLQQPGGSPALHAVRRV
LETEAAALAARSIDDEALAAAEEALAAVSGPEPVDPREFVEADIRFHQVIARACGNPVLA
VLVEAFAGRTVRARVWRAVADEQAVARTTEEHRAILAALRDHDPDRARLRMGHHLLAVED
FLAGHA
Download sequence
Identical sequences A6WFS1
gi|152968140|ref|YP_001363924.1| WP_012086047.1.7041 266940.Krad_4197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]