SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|152968242|ref|YP_001364026.1| from Kineococcus radiotolerans SRS30216

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152968242|ref|YP_001364026.1|
Domain Number 1 Region: 203-457
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.55e-25
Family Lipase 0.004
Further Details:      
 
Weak hits

Sequence:  gi|152968242|ref|YP_001364026.1|
Domain Number - Region: 26-86
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.023
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|152968242|ref|YP_001364026.1|
Sequence length 459
Comment hypothetical protein Krad_4299 [Kineococcus radiotolerans SRS30216]
Sequence
MARSTRGLTPPAPASGRLPRVLQDVATWTTVLGAAGCAGAALWRAVRSRPHPATRVLLLA
AAAVVLAGAVVTSLDGGPRWQVAPLAAAVLLALPAGARSARRGRRGPRVLLGAAAVLAVG
AGSVAVRAFPPLRLPVPSGPHPVGVGEIAWAGPATDCPASGLLAQVWYPAAAAGGDPGPY
LGRDRDEARRVSAALADAFGVPPVLLREAAVGRGRAVPGTPVAAGRFPVVLFSPGNLGVR
RQNSAWATDLASRGRVVVALDHPCDSAVVVGPEGEAVTSTAGGSGDDARDQADADRRVGV
RAQQLRSALDELARRDSADRLLGGHLDLGAVAAAGHSLGGAAALRAAAQDERVDAVVDLD
GFPRGADGLDVPVLVLVAGRGTGDPGADARYARAVEAVTAGSPDARVVEVAGASHLTFTD
APLFLPPLPGLVGSLGREGAVAATARATEEFLADVLGPR
Download sequence
Identical sequences A6WG23
gi|152968242|ref|YP_001364026.1| 266940.Krad_4299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]