SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|152968393|ref|YP_001364177.1| from Kineococcus radiotolerans SRS30216

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152968393|ref|YP_001364177.1|
Domain Number 1 Region: 72-251
Classification Level Classification E-value
Superfamily GAF domain-like 4.71e-39
Family IclR ligand-binding domain-like 0.00074
Further Details:      
 
Domain Number 2 Region: 8-81
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000249
Family Transcriptional regulator IclR, N-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|152968393|ref|YP_001364177.1|
Sequence length 254
Comment IclR family transcriptional regulator [Kineococcus radiotolerans SRS30216]
Sequence
MATPNGAPTVAAALRILSFMAAQQGPVAAATLARSLDLPRSSVYRLLAELAGQGFVLHFP
EARRYGLGIAAFELSSGYVRQEPVTRLGRPVLAALVDRVGESAHLAVLAGREVVYLVEER
APRRPALVTDVEVRLPSHLTASGRALLAALPREQVRALFPDPSAFTRRGAATQTAAGLRS
ELVATRARGYAVEDGEITEGLASVAVAVRDRSGWPVCSLALTFPAGDVDEARRSGFVEVL
LRHAADLRRRLHGG
Download sequence
Identical sequences A6WGH4
gi|152968393|ref|YP_001364177.1| 266940.Krad_4454 WP_012085780.1.7041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]