SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|157283906|ref|YP_001468174.1| from Kineococcus radiotolerans SRS30216

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|157283906|ref|YP_001468174.1|
Domain Number 1 Region: 66-308
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 4.45e-28
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|157283906|ref|YP_001468174.1|
Sequence length 310
Comment BNR/Asp-box repeat-containing protein [Kineococcus radiotolerans SRS30216]
Sequence
MTTLSRPRIRVPLRAATLSAALLLAGCSSAEPAVDPAAVEQHGGDVEGGESQHSEGQHDG
GDAVTLPSAHVHGVAVNPADGQVHLATHDGLFRFEESGPVRVGPVIDLMGFTVAGPDHFY
ASGHPGPGVDLPQPVGLIETTDGGRTWQALSRQGESDFHALAASAGGVVGFDGTLRFSSD
GTTWNVLQTPVKPYAVAASPDGAVLLVTSEAGPARSTDAGITWSVLQEAPLLQLVDWADG
ATVAGVSPEGTVAMSTDAGATWSVRGRVTGAPQAVGADLQPDGSMRLLVVTEEGVHESRD
GGASFSPVPL
Download sequence
Identical sequences A6WGW1
266940.Krad_4591 WP_012001972.1.7041 gi|157283906|ref|YP_001468174.1| gi|157283906|ref|YP_001468174.1|NC_009806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]