SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|152963999|ref|YP_001359783.1| from Kineococcus radiotolerans SRS30216

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152963999|ref|YP_001359783.1|
Domain Number 1 Region: 81-223
Classification Level Classification E-value
Superfamily Sortase 5.36e-33
Family Sortase 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|152963999|ref|YP_001359783.1|
Sequence length 238
Comment sortase family protein [Kineococcus radiotolerans SRS30216]
Sequence
MIRRATSVLGELLVTAGVLTLLFVVWQLHWTDLTSGRAQAATVTSLQQQWDAAPAPTATA
GAAATAAPTAPATARAVDETPPTGDAFAILHVPRFGEDYAVPVVEGTGTEELKEGIGHYA
DAALPGEVGNFAIAGHRVTYGKPFHLIADLQEGDAVVVATATQWFTYRVRSHEVVSPKQV
SVIAPVPGRPGETPTEAWLTMTACHPMHSARQRYVVHAQLESVQDRSAGPPASLTAAG
Download sequence
Identical sequences A6W3Y0
WP_012085665.1.7041 266940.Krad_0027 gi|152963999|ref|YP_001359783.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]