SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|152964520|ref|YP_001360304.1| from Kineococcus radiotolerans SRS30216

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152964520|ref|YP_001360304.1|
Domain Number 1 Region: 21-93
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.58e-18
Family GntR-like transcriptional regulators 0.02
Further Details:      
 
Domain Number 2 Region: 111-245
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.00000000000000863
Family GntR ligand-binding domain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|152964520|ref|YP_001360304.1|
Sequence length 263
Comment GntR family transcriptional regulator [Kineococcus radiotolerans SRS30216]
Sequence
MTQTDAARSRAGATPGTAGTGGPRVAAVTERLVTAIATGQYLPGSRLPPERDLAAALGAG
RMTVRAALAHLARRGLIETHRGRHGGSFVLQQWPDSSTEIVGRTLSATYAQLRDLCEAIA
RLHGAVCRAAAEHRSPADLERIGAALEAYAAAGSGLASQQADSALHLALIDAAHNDTLRR
VLADLEGQLSIGAPAHLWGAPEGMHAMEARALREHRDLVAAVAGRRADDAERIARAHVAI
DLELLSAALARTGALPAGTPTAP
Download sequence
Identical sequences A6W5F1
266940.Krad_0551 WP_012085123.1.7041 gi|152964520|ref|YP_001360304.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]