SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|152965434|ref|YP_001361218.1| from Kineococcus radiotolerans SRS30216

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152965434|ref|YP_001361218.1|
Domain Number 1 Region: 327-498
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.94e-42
Family Ribonuclease PH domain 1-like 0.000000355
Further Details:      
 
Domain Number 2 Region: 9-152
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.06e-41
Family Ribonuclease PH domain 1-like 0.000000388
Further Details:      
 
Domain Number 3 Region: 153-265
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.36e-24
Family Ribonuclease PH domain 2-like 0.00000924
Further Details:      
 
Domain Number 4 Region: 480-579
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 9.81e-24
Family Ribonuclease PH domain 2-like 0.0000119
Further Details:      
 
Domain Number 5 Region: 582-694
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.85e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0038
Further Details:      
 
Domain Number 6 Region: 270-351
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 3.92e-18
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|152965434|ref|YP_001361218.1|
Sequence length 746
Comment polynucleotide phosphorylase/polyadenylase [Kineococcus radiotolerans SRS30216]
Sequence
MEGPEITAAEAVIDNGSFGTRTIRFETGRLAKQAAGSAAVYLDGESFLLSATTAGKSPKD
QFDFFPLTVDVEERSYAAGKIPGSFFRREGRPSTEAILTCRLIDRPLRPSFVKGLRNEVQ
VVVSVMALHPDDAYDVVAINVASLSTQLSGLPFSGPIGGVRIALIDGQWVAFPRYSELER
AVFDMVVAGRVVTTADGSQDVAIMMVEAEATEGSWNLIKDQGATAPTEEVVAAGLEAAKP
FIAELVRAQAEVAATAAKPTAAFPTFPDYQDDVYQAVFEAASADLTAALQIGGKQDRETR
IDEVKEAVKAQLADAFAGREKEVSAAYRSVQKALIRQRVLKDGVRIDGRGLADIRTLSAE
VEVLPRVHGSALFERGETQILGVTTLNMLRMEQQLDTLSPVTRKRYMHNYNFPPYSTGET
GRVGSPKRREIGHGALAERALVPVLPAREDFPYAIRQVSEALGSNGSTSMGSVCASTLSL
LNAGVPLRAAVAGIAMGLISDTVDGETRYAALTDILGAEDAFGDMDFKVAGTKEFVTAIQ
LDTKLDGIPASVLAGALTQARDARLHILDVMAEAIDAPDEMSPTAPRIITVKVPVDKIGE
VIGPKGKMINQIQEDTGADISIEDDGTVFIGAVDGPSAEAARAAVNAIANPTMPEVGERY
LGTVVKTTTFGAFVSLMPGKDGLLHISQLRKLSGGKRVDNVEDVVAVGQKVQVEIAEIDP
RGKLSLVPVVAEEASAEAAAAEPADA
Download sequence
Identical sequences A6W815
gi|152965434|ref|YP_001361218.1| 266940.Krad_1466 WP_011981907.1.7041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]