SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|152967050|ref|YP_001362834.1| from Kineococcus radiotolerans SRS30216

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152967050|ref|YP_001362834.1|
Domain Number 1 Region: 76-225
Classification Level Classification E-value
Superfamily Sortase 0.0000000000000549
Family Sortase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|152967050|ref|YP_001362834.1|
Sequence length 226
Comment peptidase C60 sortase A and B [Kineococcus radiotolerans SRS30216]
Sequence
MRPRAGVRAVLACALALVGVLLIAGWWLARPAAGFGTPLPAPPAAAPAPTAPALAPGPVV
TAAVPAPVGRRDAAPVPAAPEPVPVRLEVPALGVDAPVVPVGVDGAGALAVPDDPRVVGW
YRWGPVPGEAGNAVLAGHVDTRDAGPGALFDLQDVADGMLVRVTSSDGSVSEHAVTARRS
YPKDELPTGELFARQGPPQLVLVTCGGDFDPRTGTYEDNVVVTARA
Download sequence
Identical sequences A6WCN1
gi|152967050|ref|YP_001362834.1| WP_012087179.1.7041 266940.Krad_3106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]