SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118465079|ref|YP_883596.1| from Mycobacterium avium 104

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118465079|ref|YP_883596.1|
Domain Number 1 Region: 39-577
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 9.74e-127
Family Arylsulfatase 0.00000088
Further Details:      
 
Weak hits

Sequence:  gi|118465079|ref|YP_883596.1|
Domain Number - Region: 631-748
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00119
Family Laminin G-like module 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|118465079|ref|YP_883596.1|
Sequence length 789
Comment arylsulfatase [Mycobacterium avium 104]
Sequence
MVAGSGQSAEFSGRVELDIRDSEPDWGPYAAPTAPPNAPNILYLVWDDTGIATWDCFGGL
VEMPAMSRIAERGVRLSQFHTTALCSPTRAALLTGRNATTVGMATIEEFTEGFPNANGRI
PFDTALLSEALAEHGYNTYCVGKWHLTPLEESNMASTKRHWPTSRGFERFYGFLGGETDQ
WYPDLVYDNHPVSPPATPEDGYHLSKDLADKTIEFIRDAKVIAPEKPWFSYVCPGAGHAP
HHVFKEWADRYAGRFDMGYERYREVVLERQKAMGIVPSDTELSPVNPYLDVTGPSGEPWP
LQDTVRPWDSLNDEEKKLFARMAEVFAGFLSYTDAQIGRILDYLEESGQLDDTIIVVISD
NGASGEGGPNGSVNEGKFFNGYIDTVEESMKLFDQLGGPQTYNHYPIGWAMAFNTPYKLY
KRYASHEGGIADTAIISWPNGIAAHGEIRDNYVNVCDITPTVYDLLGMSPPETVKGIAQK
PLDGVSFKAALDDPNADTGKTTQFYTMLGTRGIWHEGWFANTVHAATPAGWSHFDADRWE
LFHIEADRSQCHDLAAENPDKLEELKALWFAEAARYNGLPLSDLNILETMTRSRPYLVGE
RDSYVYYPDCADVGIGAAAEIRGRSFSVLAEATVDTTGAEGVLFKQGGAHGGHVLFIQDG
RLHYVYNFLGERQQEVSSSVPVPLGRHLFGASYARTGTVPDSHTPLGDLTLFIDDEVVGT
LAGVSTHPGTFGLAGAGITVGRNGGSGVSSRFKAPFVFTGGTIARVTLDLSGRPYRDVET
EIALAFSRD
Download sequence
Identical sequences A0A0H2ZZR5 A0A1X0CCC2 A0A2A2ZEK0 A0A2A3L1H5
WP_011726077.1.100504 WP_011726077.1.14691 WP_011726077.1.14816 WP_011726077.1.15384 WP_011726077.1.16945 WP_011726077.1.17321 WP_011726077.1.17624 WP_011726077.1.20882 WP_011726077.1.32203 WP_011726077.1.35384 WP_011726077.1.40244 WP_011726077.1.42004 WP_011726077.1.42684 WP_011726077.1.44666 WP_011726077.1.48008 WP_011726077.1.49379 WP_011726077.1.50439 WP_011726077.1.55945 WP_011726077.1.57680 WP_011726077.1.59206 WP_011726077.1.61195 WP_011726077.1.62105 WP_011726077.1.62113 WP_011726077.1.65674 WP_011726077.1.67083 WP_011726077.1.69393 WP_011726077.1.70933 WP_011726077.1.71252 WP_011726077.1.7463 WP_011726077.1.74957 WP_011726077.1.75695 WP_011726077.1.75798 WP_011726077.1.7926 WP_011726077.1.85628 WP_011726077.1.87736 WP_011726077.1.92407 WP_011726077.1.93735 WP_011726077.1.94747 WP_011726077.1.96060 WP_011726077.1.98724 gi|118465079|ref|YP_883596.1| 243243.MAV_4461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]