SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|237653142|ref|YP_002889456.1| from Thauera sp. MZ1T

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|237653142|ref|YP_002889456.1|
Domain Number 1 Region: 75-209,246-315
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 3.27e-21
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.015
Further Details:      
 
Weak hits

Sequence:  gi|237653142|ref|YP_002889456.1|
Domain Number - Region: 432-629
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.000118
Family YVTN repeat 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|237653142|ref|YP_002889456.1|
Sequence length 633
Comment alkaline phosphatase [Thauera sp. MZ1T]
Sequence
MSHRLRHALETFSLSLLAAATLAACTGDDDTPPPPPATETAPAPQAPAPERTPISLRLER
IGGYATNLFGKSAAEIPAYDPASKRAFVVNADAGAVDVLDLANPATPISVGRLDSQALLA
GSEINSVAVRDGVVAVAIQASPKTDKGRVALYRAADLSLLGSVEVGALPDMLTFTPDGKT
VLVANEGEPNDDYSIDPEGSISVIDVSTPTAPVARSAGFTAFNGQEKALRAQGVRIYGPG
ASAAQDLEPEYIAVSADGATAWATLQENNALARIDVAKATVEAILPLGDKDHGVDANAFD
PSDTDKKAVIQAWPGVRGLYLPDAIASYTHQGRTLLVTANEGDARTWGEGDDAYWDGDAS
KGFVEEFRVKHLTNTRGWTGRKGDDLPPQLDALADGGLLDPTVFAYCGAVAGNPGKCRDD
DQLGRLNITWTMGYRQDADGKPILFDTAGNENPAGTRLMYDTLYAFGGRSFSIRDADGKL
VWDSGAEIERFLASDECKLGSARNIPCATWFNTNHEEGNTLDNRSDNKGAEPEGVALGRI
GDKTFAFVGLERMGGVLVYDITDPQAPTRVDYLNPREDWSTKDPSTVLASVGDLGPEGLH
FIPAKDSPNAKPLLLVGNEVSGTTAVYQLNLSY
Download sequence
Identical sequences C4K9K3
WP_012585514.1.58410 gi|237653142|ref|YP_002889456.1| 85643.Tmz1t_2477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]