SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|237653273|ref|YP_002889587.1| from Thauera sp. MZ1T

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|237653273|ref|YP_002889587.1|
Domain Number 1 Region: 126-540
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 4.05e-77
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.00013
Further Details:      
 
Domain Number 2 Region: 8-119
Classification Level Classification E-value
Superfamily Cytochrome c 1.69e-16
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|237653273|ref|YP_002889587.1|
Sequence length 547
Comment cytochrome d1 heme region [Thauera sp. MZ1T]
Sequence
MKIRASTLTGLFALAGALVVLPAAASPDKAVARAASGAAASPAAIDVPALYAQHCAACHA
PNRLGAMGPALLPDNLGRLRKSEAAKVIAEGRPATQMAGFAAQLGKDEIAALTEWIYTPV
VPEPRWTDEDIRASRVVHVDTATLSDKPVFDADPLNLFLVVEAGDHHVSVLDGDRLEPIH
RFQSRFALHGGPKFAANGRYVFFASRDGWITKFDLWNLKVVAEVRAGINTRNVAASPDGT
HVAVANYLPNTLVLLDGELNLVKTIPAMDRDGKKSSRVSAVYDATPRQSFIAALKDVGEV
WEISYTKAVEDIPVSYIHDYTQREGSFIPGYLNPRRTILAEVLDDFFFTQDYSELMGASR
EGVGQVVNLDVRKKIANLPLDGMPHLGSGITWEWQDPAAGPGARPRTVMASTNLKAGEVT
VIDMKTWEVVKRIPTRGPGFFLRSHSSSRYAFVDSMMSAEAKHILQVIDKQTLEVVREIT
GEPGKTLAHVEFTRDGRHALASLWEDDGAVIVYDARTLEEVKRLPMRKPVGKYNVWNKIT
REEGTSH
Download sequence
Identical sequences C4K9Y4 N6Z5A9
gi|237653273|ref|YP_002889587.1| 85643.Tmz1t_2608 WP_004301755.1.58410 WP_004301755.1.88725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]