SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|237653278|ref|YP_002889592.1| from Thauera sp. MZ1T

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|237653278|ref|YP_002889592.1|
Domain Number 1 Region: 15-398
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 1.31e-71
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|237653278|ref|YP_002889592.1|
Sequence length 402
Comment cytochrome d1 heme region [Thauera sp. MZ1T]
Sequence
MSCREVRLAPPALWGVVLSAMVVLLSACSSVPPVAVRGTGDLGVVIERADGKVKVIETTG
RSVLATVDGLGDLSHASVVFSRDGRYAFVFGRDGGLTKVDLLARRIVGRKVQAGNAIGGS
ISHDGSLVVVQNYEPGGIKAFDANTLELVADVPATTDDGTRSKVVGLADLSGKRFIYSLF
EAGEIRITDFSDPKNPLTRRFAGGKQPYDALVTPDGRYYIAGLFGEDGLALIDLWNLDKG
SRKILSGYGRGEQPLPVFKMPHLRGWSIAGNRAYLPAIGRHEVLVVDTATWQEVDRIQVK
SQPVFAMARPDGREIWVNFAFPDNGWVQVIDTVSGKVTDTLQPGRGILHMEFLSKGHEIW
LSARDDNKVVIYDTASKQPIGGFESASPSGIFFTTRAARTGF
Download sequence
Identical sequences C4K9Y9
85643.Tmz1t_2613 gi|237653278|ref|YP_002889592.1| WP_012585575.1.58410 WP_012585575.1.88725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]