SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|237653283|ref|YP_002889597.1| from Thauera sp. MZ1T

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|237653283|ref|YP_002889597.1|
Domain Number 1 Region: 129-560
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 1.27e-115
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.000000000104
Further Details:      
 
Domain Number 2 Region: 15-139
Classification Level Classification E-value
Superfamily Cytochrome c 3.29e-19
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|237653283|ref|YP_002889597.1|
Sequence length 560
Comment nitrite reductase (NO-forming) [Thauera sp. MZ1T]
Sequence
MQKKGLIGSAFAMGVLSLAMSSAWAQEAPKLTAEEMEKGKQIYFERCAGCHGVLRKGATG
KNLEPHWTKTAPDGTKLEGGTLKLGTERLEKIISYGTEGGMVNYDDILTKEEINLMARYI
QNTPPIPPEFSLKDMKDSWKLLVPVKDRPTKQMNKVNLKNVFAITLRDAGKLALVDGDTH
KIWKILDTGYAVHISRLSASGRYVYTVGRDGLTTIIDMFYEEPTTVATVRLGSDARSVDT
SKFKGYEDKYLIGGTYWPPQYSIMDGETLEPMKIVSTRGNTVDGDYHPEPRVASIVASMT
KPEWVVNVKETGQILLVDYSDIKNLKSIAIESAKFLHDGGWDMSKRYFMVAANASNKVAA
VDTKEGKLAALVDTAKIPHPGRGANFVHPKFGPVWSTGHLGDAVVSLISTASDDPKFAKY
KEHNWKVVEQLKMPGAGNLFVKTHPKSKHFWADAPMNPEREVAESVYVFDMNDLSKAPVA
LNVAKDSGLPESKAIRRAVQPEYNEAGDEVWISLWGGKTDQSAIVIYDDKTLKVKKVITD
PAIVTPTGKFNVYNTMHDVY
Download sequence
Identical sequences C4K9Z4
gi|237653283|ref|YP_002889597.1| WP_012585579.1.50204 WP_012585579.1.58410 85643.Tmz1t_2618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]